Anti-CD41 Antibody [ARC0620], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81216-100
Artikelname: Anti-CD41 Antibody [ARC0620], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81216-100
Hersteller Artikelnummer: A81216-100
Alternativnummer: ABC-A81216-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD41/ITGA2B (P08514).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0620] antibody to CD41.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0620]
Molekulargewicht: 137 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLL
Target-Kategorie: CD41
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200