Anti-RIG-I/DDX58 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8429-100
Artikelname: Anti-RIG-I/DDX58 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8429-100
Hersteller Artikelnummer: A8429-100
Alternativnummer: ABC-A8429-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 830 to the C-terminus of human Rig-I/DDX58 (NP_055129.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to RIG-I/DDX58.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 107 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: HYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK
Target-Kategorie: RIG-I/DDX58
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:2,000-1:4,000