Anti-DUSP6 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8444-100
Artikelname: Anti-DUSP6 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8444-100
Hersteller Artikelnummer: A8444-100
Alternativnummer: ABC-A8444-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence within amino acids 302-381 of human DUSP6 (NP_001937.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to DUSP6.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: TVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST
Target-Kategorie: DUSP6
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:20-1:50