Anti-GFP Antibody, Unconjugated, Gallus, Polyclonal

Artikelnummer: ABC-A85300-10
Artikelname: Anti-GFP Antibody, Unconjugated, Gallus, Polyclonal
Artikelnummer: ABC-A85300-10
Hersteller Artikelnummer: A85300-10
Alternativnummer: ABC-A85300-10
Hersteller: Antibodies.com
Wirt: Gallus
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Immunogen: Recombinant Aequoria coerulescens GFP protein, expressed in and purified from E. coli.
Konjugation: Unconjugated
Chicken polyclonal antibody to GFP.
Klonalität: Polyclonal
Konzentration: 1 mg/ml
Molekulargewicht: 27 kDa
Puffer: Supplied in Phosphate Buffered Saline with 50% Glycerol and 5mM Sodium Azide.
Formulierung: Liquid
Sequenz: MVSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYK
Target-Kategorie: GFP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000, ICC/IF: 1:1,000-1:5,000, IHC: 1:1,000-1:5,000