Anti-PRKAR1B Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8531-100
Artikelname: Anti-PRKAR1B Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8531-100
Hersteller Artikelnummer: A8531-100
Alternativnummer: ABC-A8531-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 190-290 of human PRKAR1B (NP_002726.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PRKAR1B.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 43 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: WVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGD
Target-Kategorie: PRKAR1B
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:4,000