Anti-MGAT5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8655-100
Artikelname: Anti-MGAT5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8655-100
Hersteller Artikelnummer: A8655-100
Alternativnummer: ABC-A8655-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 627-741 of human GNT-V/MGAT5 (NP_002401.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MGAT5.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 100 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: HGQVMWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL
Target-Kategorie: MGAT5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500