Anti-NPFF2 Receptor Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8723-100
Artikelname: Anti-NPFF2 Receptor Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8723-100
Hersteller Artikelnummer: A8723-100
Alternativnummer: ABC-A8723-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human NPFFR2 (NP_004876.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NPFF2 Receptor.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 48 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRRLGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYY
Target-Kategorie: NPFF2 Receptor
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000