Anti-LeuRS Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88179-100
Artikelname: Anti-LeuRS Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88179-100
Hersteller Artikelnummer: A88179-100
Alternativnummer: ABC-A88179-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human LARS (NP_064502.9).
Konjugation: Unconjugated
Rabbit polyclonal antibody to LeuRS.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 134 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MAERKGTAKVDFLKKIEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEETSVKTEDIIIKDKAKGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKFSEAEHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQT
Target-Kategorie: LeuRS
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200