Anti-Collagen I Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88196-100
Artikelname: Anti-Collagen I Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88196-100
Hersteller Artikelnummer: A88196-100
Alternativnummer: ABC-A88196-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human Collagen I/COL1A1 (NP_000079.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Collagen I.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 140 kDa / 220 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: GEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF
Target-Kategorie: Collagen I
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000, IHC: 1:2,000-1:10,000, ICC/IF: 1:50-1:200