Anti-KRBOX4 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88669-100
Artikelname: Anti-KRBOX4 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88669-100
Hersteller Artikelnummer: A88669-100
Alternativnummer: ABC-A88669-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to amino acids 100 to the C-terminus of human KRBOX4.
Konjugation: Unconjugated
Rabbit polyclonal antibody to KRBOX4.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 20 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: WQAAFIGKETLKDESGQESRTCRKSIYLSTEFDSVRQRLPKYYSWEKAFKTSFKLSWSKWKLCKKER
Target-Kategorie: KRBOX4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000