Anti-DCTN5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88670-100
Artikelname: Anti-DCTN5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88670-100
Hersteller Artikelnummer: A88670-100
Alternativnummer: ABC-A88670-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DCTN5 (NP_115875.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to DCTN5.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 20 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVN
Target-Kategorie: DCTN5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000