Anti-FUNDC1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88727-100
Artikelname: Anti-FUNDC1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88727-100
Hersteller Artikelnummer: A88727-100
Alternativnummer: ABC-A88727-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human FUNDC1 (NP_776155.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FUNDC1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 17 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: VATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFL
Target-Kategorie: FUNDC1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000