Anti-TRUB2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89521-100
Artikelname: Anti-TRUB2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89521-100
Hersteller Artikelnummer: A89521-100
Alternativnummer: ABC-A89521-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 122-331 of human TRUB2 (NP_056494.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TRUB2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 37 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ
Target-Kategorie: TRUB2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000