Anti-IL-17A Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89567-100
Artikelname: Anti-IL-17A Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89567-100
Hersteller Artikelnummer: A89567-100
Alternativnummer: ABC-A89567-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL17A (NP_002181.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to IL-17A.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 18 - 25 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCI
Target-Kategorie: IL-17A
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000, IHC: 1:50-1:200