Anti-TAS2R38 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89594-100
Artikelname: Anti-TAS2R38 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89594-100
Hersteller Artikelnummer: A89594-100
Alternativnummer: ABC-A89594-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human TAS2R38 (NP_789787.4).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TAS2R38.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: CSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLV
Target-Kategorie: TAS2R38
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000