Anti-ACMSD Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89634-100
Artikelname: Anti-ACMSD Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89634-100
Hersteller Artikelnummer: A89634-100
Alternativnummer: ABC-A89634-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-336 of human ACMSD (NP_612199.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ACMSD.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKY
Target-Kategorie: ACMSD
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000