Anti-CD82 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8965-100
Artikelname: Anti-CD82 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8965-100
Hersteller Artikelnummer: A8965-100
Alternativnummer: ABC-A8965-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human CD82 (NP_002222.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CD82.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: CGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSI
Target-Kategorie: CD82
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200