Anti-YOD1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89774-100
Artikelname: Anti-YOD1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89774-100
Hersteller Artikelnummer: A89774-100
Alternativnummer: ABC-A89774-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-348 of human YOD1 (NP_061036.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to YOD1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 43 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGY
Target-Kategorie: YOD1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000