Anti-FGF1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92157-100
Artikelname: Anti-FGF1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92157-100
Hersteller Artikelnummer: A92157-100
Alternativnummer: ABC-A92157-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2-155 of human FGF1 (NP_000791.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FGF1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Target-Kategorie: FGF1
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200