Anti-CDK5RAP2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92174-100
Artikelname: Anti-CDK5RAP2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92174-100
Hersteller Artikelnummer: A92174-100
Alternativnummer: ABC-A92174-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1744-1893 of human CDK5RAP2 (NP_060719.4).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CDK5RAP2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 250 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: GQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSRPGS
Target-Kategorie: CDK5RAP2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000