Anti-Complex IV Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92177-100
Artikelname: Anti-Complex IV Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92177-100
Hersteller Artikelnummer: A92177-100
Alternativnummer: ABC-A92177-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human COX7A1 (NP_001855.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Complex IV.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 9 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
Target-Kategorie: Complex IV
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200