Anti-SLC25A19 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92178-100
Artikelname: Anti-SLC25A19 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92178-100
Hersteller Artikelnummer: A92178-100
Alternativnummer: ABC-A92178-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A recombinant fusion protein corresponding to amino acids 1-80 of human SLC25A19.
Konjugation: Unconjugated
Rabbit polyclonal antibody to SLC25A19.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 36kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWK
Target-Kategorie: SLC25A19
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:2,000, ICC/IF: 1:50-1:200