Anti-SCDGFB/PDGF-D Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92184-100
Artikelname: Anti-SCDGFB/PDGF-D Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92184-100
Hersteller Artikelnummer: A92184-100
Alternativnummer: ABC-A92184-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human PDGFD (NP_079484.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SCDGFB/PDGF-D.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALV
Target-Kategorie: SCDGFB/PDGF-D
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000