Anti-S100A12 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92195-100
Artikelname: Anti-S100A12 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92195-100
Hersteller Artikelnummer: A92195-100
Alternativnummer: ABC-A92195-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P
Spezies Reaktivität: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-92 of human S100A12.
Konjugation: Unconjugated
Rabbit polyclonal antibody to S100A12.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 10kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Target-Kategorie: S100A12
Antibody Type: Primary Antibody
Application Verdünnung: IHC-P: 1:100-1:500