Anti-S100A5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92196-100
Artikelname: Anti-S100A5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92196-100
Hersteller Artikelnummer: A92196-100
Alternativnummer: ABC-A92196-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A5 (NP_002953.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to S100A5.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 11 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Target-Kategorie: S100A5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:100-1:200