Anti-LRP6 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92227-100
Artikelname: Anti-LRP6 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92227-100
Hersteller Artikelnummer: A92227-100
Alternativnummer: ABC-A92227-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human LRP6 (NP_002327.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to LRP6.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSG
Target-Kategorie: LRP6
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200