Anti-SLC24A5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92261-100
Artikelname: Anti-SLC24A5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92261-100
Hersteller Artikelnummer: A92261-100
Alternativnummer: ABC-A92261-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human SLC24A5 (NP_995322.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SLC24A5.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: INQYIIKKCSPCCACLAKAMERSEQQPLMGWEDEGQPFIRRQSRTDSGIFYEDSGYSQLSISLHGLSQVSEDPPSVFNMPE
Target-Kategorie: SLC24A5
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200