Anti-Defb26 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92264-100
Artikelname: Anti-Defb26 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92264-100
Hersteller Artikelnummer: A92264-100
Alternativnummer: ABC-A92264-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-128 of rat Defb26 (NP_001032595.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Defb26.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: WRRMPPKCWKDNLGRCRVRCRGDERYIYLCRNKANCCILLTLAEDQSAHPKPTSVHPENVTWKNTSISPTTRYIDDITLDKTSIGTPTNVAGIGKALNLTVITPTHP
Target-Kategorie: Defb26
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200