Anti-IL-28B Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92269-100
Artikelname: Anti-IL-28B Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92269-100
Hersteller Artikelnummer: A92269-100
Alternativnummer: ABC-A92269-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 22-196 of human IL-28B.
Konjugation: Unconjugated
Rabbit polyclonal antibody to IL-28B.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 22kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Target-Kategorie: IL-28B
Antibody Type: Primary Antibody
Application Verdünnung: IHC-P: 1:50-1:200