Anti-SPINK1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92293-100
Artikelname: Anti-SPINK1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92293-100
Hersteller Artikelnummer: A92293-100
Alternativnummer: ABC-A92293-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, ICC
Spezies Reaktivität: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 24-79 of human SPINK1.
Konjugation: Unconjugated
Rabbit polyclonal antibody to SPINK1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 9kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Target-Kategorie: SPINK1
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200