Anti-ALDH1B1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92327-100
Artikelname: Anti-ALDH1B1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92327-100
Hersteller Artikelnummer: A92327-100
Alternativnummer: ABC-A92327-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 278-517 of human ALDH1B1 (NP_000683.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ALDH1B1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: NLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Target-Kategorie: ALDH1B1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200