Anti-DNase I Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92356-100
Artikelname: Anti-DNase I Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92356-100
Hersteller Artikelnummer: A92356-100
Alternativnummer: ABC-A92356-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-235 of human DNASE1 (NP_005214.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to DNase I.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: IQTFGETKMSNATLVSYIVQILSRYDIALVQEVRDSHLTAVGKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYDDGCEPCGNDTFNREPAIVRFFSRFTEVREFAIVPLHAAPGDAVAEIDALYDVYLDVQEKWGLEDVMLMGDFNAGCSYVRPSQWSSIRLWTSPTFQWLIPDSADTTATPTHCAYDR
Target-Kategorie: DNase I
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200