Anti-Adenine Nucleotide Translocator 1/ANT 1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92404-100
Artikelname: Anti-Adenine Nucleotide Translocator 1/ANT 1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92404-100
Hersteller Artikelnummer: A92404-100
Alternativnummer: ABC-A92404-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A4/ANT1 (NP_001142.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Adenine Nucleotide Translocator 1/ANT 1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: LGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKG
Target-Kategorie: Adenine Nucleotide Translocator 1/ANT 1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200