Anti-SLCO6A1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92429-100
Artikelname: Anti-SLCO6A1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92429-100
Hersteller Artikelnummer: A92429-100
Alternativnummer: ABC-A92429-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 480-580 of human SLCO6A1 (NP_775759.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SLCO6A1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 80 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: VQFAGINEDYDGTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYFSPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL
Target-Kategorie: SLCO6A1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000