Anti-ZNF177 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92439-100
Artikelname: Anti-ZNF177 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92439-100
Hersteller Artikelnummer: A92439-100
Alternativnummer: ABC-A92439-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-110 of human ZNF177 (NP_003442.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ZNF177.
Klonalität: Polyclonal
Konzentration: Lot Specific
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGI
Target-Kategorie: ZNF177
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:50-1:200, ICC/IF: 1:50-1:200