Anti-NGDN Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92468-100
Artikelname: Anti-NGDN Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92468-100
Hersteller Artikelnummer: A92468-100
Alternativnummer: ABC-A92468-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 61-209 of human NGDN.
Konjugation: Unconjugated
Rabbit polyclonal antibody to NGDN.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 36kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL
Target-Kategorie: NGDN
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000