Anti-ERG2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92483-100
Artikelname: Anti-ERG2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92483-100
Hersteller Artikelnummer: A92483-100
Alternativnummer: ABC-A92483-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-220 of human KCNH6 (NP_110406.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ERG2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 110 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: TGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVT
Target-Kategorie: ERG2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000