Anti-Uhrf2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A92497-100
Artikelname: Anti-Uhrf2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A92497-100
Hersteller Artikelnummer: A92497-100
Alternativnummer: ABC-A92497-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 76-359 of mouse Uhrf2 (NP_659122.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Uhrf2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 90 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDP
Target-Kategorie: Uhrf2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000