CD70 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Cluster of Differentiation 70 (CD70 also known as CD27 ligand, CD27L, Tumor necrosis factor ligand superfamily member 7, TNFSF7). Sequence data: hCD70 (accession number NP_001243) MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQA QQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDG IYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTP LARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Application Verdünnung:
Application:. Screen for antibodies of human CD70 through Flow Cytometry. Culture conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten