ACVR2B monoclonal antibody (MP03J), clone 1C11 (PE), Clone: [1C11], Mouse, Monoclonal

Artikelnummer: ABN-H00000093-MP03J
Artikelname: ACVR2B monoclonal antibody (MP03J), clone 1C11 (PE), Clone: [1C11], Mouse, Monoclonal
Artikelnummer: ABN-H00000093-MP03J
Hersteller Artikelnummer: H00000093-MP03J
Alternativnummer: ABN-H00000093-MP03J-50,ABN-H00000093-MP03J-3
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: FC, IF, WB
Spezies Reaktivität: Human
Immunogen: ACVR2B (NP_001097, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Konjugation: PE
PE conjugated mouse monoclonal antibody raised against a partial recombinant ACVR2B.This product is belong to Cell Culture Grade Antibody (CX Grade).
Klonalität: Monoclonal
Klon-Bezeichnung: [1C11]
UniProt: 93
Puffer: In 1x PBS, pH 7.4
Formulierung: Liquid
Sequenz: RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
Target-Kategorie: ACVR2B