ACYP1 monoclonal antibody (M01), clone S3, Mouse, Monoclonal

Artikelnummer: ABN-H00000097-M01
Artikelname: ACYP1 monoclonal antibody (M01), clone S3, Mouse, Monoclonal
Artikelnummer: ABN-H00000097-M01
Hersteller Artikelnummer: H00000097-M01
Alternativnummer: ABN-H00000097-M01-100
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: ACYP1 (AAH35568, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full length recombinant ACYP1.
Klonalität: Monoclonal
UniProt: 97
Puffer: In 1x PBS, pH 7.4
Sequenz: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Target-Kategorie: ACYP1