CT83 monoclonal antibody, clone CL4762, IgG1, Clone: [CL4762], Mouse, Monoclonal

Artikelnummer: ABN-MAB15717
Artikelname: CT83 monoclonal antibody, clone CL4762, IgG1, Clone: [CL4762], Mouse, Monoclonal
Artikelnummer: ABN-MAB15717
Hersteller Artikelnummer: MAB15717
Alternativnummer: ABN-MAB15717-100,ABN-MAB15717-25
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to human CT83.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against partial recombinant human CT83.
Klonalität: Monoclonal
Klon-Bezeichnung: [CL4762]
Isotyp: IgG1
UniProt: 203413
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Formulierung: Liquid
Sequenz: QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Target-Kategorie: CT83
Application Verdünnung: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:10000-1:20000)Western Blot (1:500-1:1000)The optimal working dilution should be determined by the end user.