Cxcl1 (Mouse) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7380
- Bilder (0)
| Artikelname: | Cxcl1 (Mouse) Recombinant Protein, Mammal |
| Artikelnummer: | ABN-P7380 |
| Hersteller Artikelnummer: | P7380 |
| Alternativnummer: | ABN-P7380-5 |
| Hersteller: | Abnova |
| Wirt: | Mammal |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA, SDS-PAGE |
| Spezies Reaktivität: | Mouse |
| Mouse Cxcl1 (P12850, 25 a.a. - 96 a.a.) partial recombinant protein expressed in CHO cells. |
| Tag: | None |
| UniProt: | 14825 |
| Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Formulierung: | Lyophilized |
| Sequenz: | APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK |
| Target-Kategorie: | Cxcl1 |
| Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
