Osm (Mouse) Recombinant Protein, Human
Artikelnummer:
ABN-P7383
- Bilder (0)
| Artikelname: | Osm (Mouse) Recombinant Protein, Human |
| Artikelnummer: | ABN-P7383 |
| Hersteller Artikelnummer: | P7383 |
| Alternativnummer: | ABN-P7383-10 |
| Hersteller: | Abnova |
| Wirt: | Human |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA, SDS-PAGE |
| Spezies Reaktivität: | Mouse |
| Mouse Osm (P53347, 24 a.a. - 206 a.a.) partial recombinant protein expressed in HEK293 cells. |
| Tag: | None |
| UniProt: | 18413 |
| Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Formulierung: | Lyophilized |
| Sequenz: | ANRGCSNSSSQLLSQLQNQANTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR |
| Target-Kategorie: | Osm |
| Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
