IL1RN (Human) Recombinant Protein
Artikelnummer:
ABN-P7384
- Bilder (0)
| Artikelname: | IL1RN (Human) Recombinant Protein |
| Artikelnummer: | ABN-P7384 |
| Hersteller Artikelnummer: | P7384 |
| Alternativnummer: | ABN-P7384-10 |
| Hersteller: | Abnova |
| Wirt: | Human |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA, SDS-PAGE |
| Spezies Reaktivität: | Human |
| Human IL1RN (P18510, 26 a.a. - 177 a.a.) partial recombinant protein expressed in HEK293 cells. |
| Tag: | None |
| UniProt: | 3557 |
| Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Formulierung: | Lyophilized |
| Sequenz: | RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
| Target-Kategorie: | IL1RN |
| Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
