Il10 (Rat) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7385
- Bilder (0)
| Artikelname: | Il10 (Rat) Recombinant Protein, Mammal |
| Artikelnummer: | ABN-P7385 |
| Hersteller Artikelnummer: | P7385 |
| Alternativnummer: | ABN-P7385-10 |
| Hersteller: | Abnova |
| Wirt: | Mammal |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA, SDS-PAGE |
| Spezies Reaktivität: | Rat |
| Rat Il10 (P29456, 19 a.a. - 178 a.a.) partial recombinant Protein expressed in CHO cells. |
| Tag: | None |
| UniProt: | 25325 |
| Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Formulierung: | Lyophilized |
| Sequenz: | SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN |
| Target-Kategorie: | Il10 |
| Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
