FGF7 (Human) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7386
- Bilder (0)
| Artikelname: | FGF7 (Human) Recombinant Protein, Mammal |
| Artikelnummer: | ABN-P7386 |
| Hersteller Artikelnummer: | P7386 |
| Alternativnummer: | ABN-P7386-5 |
| Hersteller: | Abnova |
| Wirt: | Mammal |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA, SDS-PAGE |
| Spezies Reaktivität: | Human |
| Human FGF7 (P21781, 32 a.a. - 194 a.a.) partial recombinant protein expressed in CHO cells. |
| Tag: | None |
| UniProt: | 2252 |
| Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Formulierung: | Lyophilized |
| Sequenz: | CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| Target-Kategorie: | FGF7 |
| Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
