Anti-Ataxin-1, 11NQ Antibody (BSA and Azide free), IgG2b, Clone: [N76/8], Unconjugated, Mouse, Monoclonal

Artikelnummer: ANI-75-117-CF
Artikelname: Anti-Ataxin-1, 11NQ Antibody (BSA and Azide free), IgG2b, Clone: [N76/8], Unconjugated, Mouse, Monoclonal
Artikelnummer: ANI-75-117-CF
Hersteller Artikelnummer: 75-117-CF
Alternativnummer: ANI-75-117-CF
Hersteller: Antibodies Incorporated
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
Konjugation: Unconjugated
Alternative Synonym: Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)
Our carrier-free Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC, IP, WB.
Klonalität: Monoclonal
Konzentration: 1 mg/mL
Klon-Bezeichnung: [N76/8]
Molekulargewicht: 85 kDa
Isotyp: IgG2b
UniProt: P54254
Puffer: PBS
Target-Kategorie: Ataxin-1, 11NQ
Antibody Type: Primary Antibody