Anti-Ataxin-1, 11NQ Antibody FL650 Conjugate, IgG2b, Clone: [N76/8], Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-Ataxin-1, 11NQ Antibody FL650 Conjugate, IgG2b, Clone: [N76/8], Mouse, Monoclonal
• Artikelnummer: ANI-75-117-FL650
• Hersteller Artikelnummer: 75-117-FL650
• Alternativnummer: ANI-75-117-FL650
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC, IHC
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
• Konjugation: FL650
• Alternative Synonym: Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)

Produktbeschreibung

Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC.

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 0.5 mg/mL
• Klon-Bezeichnung: [N76/8]
• Molekulargewicht: 85 kDa
• Isotyp: IgG2b
• UniProt: P54254
• Puffer: PBS with 0.09% azide
• Target-Kategorie: Ataxin-1, 11NQ
• Antibody Type: Primary Antibody