Anti-Ataxin-1, 11NQ Antibody (BSA and Azide free), IgG1, Clone: [N76/3], Unconjugated, Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-Ataxin-1, 11NQ Antibody (BSA and Azide free), IgG1, Clone: [N76/3], Unconjugated, Mouse, Monoclonal
• Artikelnummer: ANI-75-122-CF
• Hersteller Artikelnummer: 75-122-CF
• Alternativnummer: ANI-75-122-CF
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA, ICC, IHC, WB
• Spezies Reaktivität: Drosophila, Human, Mouse, Rat
• Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
• Konjugation: Unconjugated
• Alternative Synonym: Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)

Produktbeschreibung

Our carrier-free Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/3. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC, IP, WB.

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 1 mg/mL
• Klon-Bezeichnung: [N76/3]
• Molekulargewicht: 85 kDa
• Isotyp: IgG1
• UniProt: P54254
• Puffer: PBS
• Target-Kategorie: Ataxin-1, 11NQ
• Antibody Type: Primary Antibody